YML050W

AIM32 | SGD

Standard Name: AIM32; Systematic Name: YML050W; SGD ID: SGD: S000004514; Feature Type: ORF , Verified; Description: Protein of unknown function; null ...

yml050w

KEGG T00005: YML050W

AA seq, 311 aa AA seq DB search. MLRITVKTLQQRASFHHSFKHISVPDLHTRAQNDQTNCYCQEINARLPSKTDPLDPHIKL

yml050w

FungiDB:YML050W

yml050w

AIM32 - Altered inheritance of mitochondria protein 32 ...

YEAS7. 311. Altered inheritance of mitochondria protein 32 · YEAS8. 311. AIM32p protein · Saccharomyces sp. 'boulardii'. 311. YML050W-like protein · SACCK.

yml050w

AIM32 protein (Saccharomyces cerevisiae) - STRING interaction ...

DNA repair and recombination protein RAD26; Protein involved in transcription- coupled nucleotide excision repair; repairs UV-induced DNA lesions; recruitment  ...

yml050w

HIP HOP Results for strain with deletion in YML050W

HIP HOP results for strain with deletion in YML050W. The graph below shows the distribution of heterozygous (HIP) and homozygous (HOP) deletion strains as ...

yml050w

SCMD Photo Viewer YML050w

Hypothetical ORF ( links to: CYGD SGD ). Photo Viewer. Cell · Nucleus · Actin. YML050w. [ prev10 ] [ prev ] 1 / 15 [ next ] [ next10 ]. [Individual Cell Datasheet] ...

yml050w

AIM32 (YML050W) Result Summary | BioGRID

AIM32. YML050W. Putative protein of unknown function; null mutant is viable and displays elevated frequency of mitochondrial genome loss. GO Process (0).

yml050w

HIPHOP chemogenomics database

YML050W / AIM32. Putative protein of unknown function; null mutant is viable and displays elevated frequency of mitochondrial genome loss. Zygosity: ...

yml050w

SGD

yml050w

YTRP »» TRP Results

Gln3, YER040W, AIM32, YML050W, 1, 4 ( Info ), 1, 0. Pho4, YFR034C, AIM32, YML050W, 1, 4 ( Info ), 1, 0. Sfp1, YLR403W, AIM32, YML050W, 1, 3 ( Info ), 2, 0  ...

yml050w

SYGD

Gene ID, YML050W. Original symbol, AIM32. Assigned symbol, AIM32. Original Description, Aim32p hypothetical protein; null mutant is viable anddisplays ...

yml050w

Cluster: 4403 4404 4405 4406 4407 4408 4409 4410 4411 4412 ...

... YML050W) 4424 (92, YML049C) 4425 (93, YML048W) 4427 (95, YML047C) 4428 (96, YML046W) 4431 (99, YML043C) 4432 (100, YML042W) 4433 (101, ...

yml050w

yml050w

Download

... aaagtgattacttgcagtttcgcgaaatctcgaagaattttttcaacttattgaaagaac atgaatatacttgttaacgtgattaaacgttttatcagaacaacctaagagtatctcctt ggtgaattagaagccagata ">YML050W ...

yml050w

yml050w

yml050w

Details for GAL80

ScerTF. Details for GAL80. The Table below describes all of the matrices annotated to GAL80 in this database. For each individual matrix, we provide several ...

yml050w

Saccharomyces cerevisiae S288c Altered Inheritance rate of ...

Accession IDs, G3O-32647 (YeastCyc) YML050W S000004514 Q04689 (UniProt ), Length, 936 bp / 311 aa. Map Position ...

yml050w

Experiment details for FKH2

ScerTF. Experiment details for FKH2. The table below describes promoters bound in ChIP-chip experiments, and genes significantly affected by TF gene ...

yml050w

Experiment details for NDD1

ScerTF. Experiment details for NDD1. The table below describes promoters bound in ChIP-chip experiments, and genes significantly affected by TF gene ...

yml050w

B+/C+

... YJL051W YJL100W YJL148W YJL158C YJR091C YJR092W YJR127C YKR040C YKR044W YLR084C YLR131C YLR189C YLR190W YLR439W YML050W ...

yml050w

Supplemental Material.docx

16 Apr 2013 ... YML050W, 0.0473, 35, 12, 23. YLR092W, 0.0235, 1549, 1581, 32. YKL219W, 0.0199, 59, 72, 13. YIL120W, 0.0270, 859, 836, 23. YIL064W ...

yml050w

B+/C

... YLR189C YLR286C YLR399C YLR439W YML050W YML053C YMR197C YNL170W YNL172W YNL173C YOL023W YPL116W YPL139C YPR149W ...

yml050w

Supplemental file 1

11 Feb 2008 ... Mutants detected by the screening but not confirmed by MIC on microtitration plates. YGL071W. YGL148W. YML008C. YER086W. YHR025W.

yml050w

YGL103W 0 YGL030W 0 YPL131W 0 YAL001C 0 YBL020W 0 ...

YML050W. 0.94. YLL040C. 0.95. YDR279W. 0.95. YGL037C. 0.95. YBR007C. 0.95. YML059C. 0.95. YDR108W. 0.95. YHR189W. 0.95. YPR097W. 0.95.

yml050w

class I part 4

YML050W, XIII, 173139, 174074, biological_process unknown. YML051W, GAL80, XIII, 171594, 172901, negative regulator for expression of galactose- induced ...

yml050w

C5 C23 C27 C51 C4 C8 C13 C37 C38 C47 C10 C16 C17 C18 C21 ...

YML050W. C39. YBR235W. YDL155W. YGR223C. YJR045C. YNL247W. YOR246C. C41. YEL053C. YER034W. YER146W. YGL048C. YHL004W. YIL046W.

yml050w

Sheet1

125, YML050W, AIM32, SS. 126, YML060W, OGG1, SS*. 127, YML063W, RPS1B , SS. 128, YML097C, VPS9, SS. 129, YMR002W, MIC17, SL. 130, YMR004W ...

yml050w

YAL022C YAL040C YAL053W YAL067C YAR003W YAR007C ...

... YLR466W YLR467W YML012W YML020W YML021C YML027W YML033W YML034W YML035C-A YML050W YML052W YML058W YML060W YML061C ...

yml050w

plate42 - gTOW6000

30 Jun 2011 ... 4052, 42, F, 3, 22, 13, YML050W, 8103 (upYML050W), cggccgctctagaactagtggatccAATATCTCGCATTATAGTTTATA, 8104 ( downYML050W) ...

yml050w

Gene IDs

548, YML034W, YML034W. 549, YML035C-A, YML035C-A. 550, YML050W, YML050W. 551, YML052W, SUR7. 552, YML058W, SML1. 553, YML060W, OGG1.

yml050w

A Figure 6 B C

A. YIL167W. MRPS28. YML050W. RGT2. YHL026C. UTH1. SED1. YCR041W. YGP1. PRY1. YLR297W. MCM3. YOR066W. CDC46. GPA1. HST4. MCM6. TSM1 .

yml050w

Saccharomyces cerevisiae

YML099W-A CLG1 SSN8 MRPL27 YJL084C GRE2 YBR032W RAV2 YOR277C YML047W-A YML050W ARC1 RXT3 AAT2 RPL2B HST2 YDR008C DAP2 TIR2 ...

yml050w

Table S9

23 Feb 2019 ... 89, YML050W, YIL155C. 90, YML100W-A, YIR018W. 91, YML132W, YIR034C. 92, YMR057C, YJL002C. 93, YMR106C, YJL066C.

yml050w

See Venn diagram regulon

DNA binding targets: 4. Expression evidence targets: 744. DNA binding & Expression targets: 4. Potential targets: 3459. Potential & Expression targets: 384

yml050w

YAL022C YAL040C YAL053W YAL067C YAR003W YAR007C ...

... YLR467W YML012W YML020W YML021C YML027W YML033W YML034W YML035C-A YML050W YML052W YML058W YML060W YML064C YML065W ...

yml050w

Genetic Dissection of Transcriptional Regulation in Budding Yeast ...

YML050W YMR193W MRPL24 Mitochondrial ribosomal protein MRPL24 ( YmL24) YLR204W QRI5 YDR347W MRP1 37 kDa mitochondrial ribosomal protein

yml050w

Organism Scer

Gene Name, Name, SwissProt, PID, Protein Name, Other Names. YLR317W . . 2258168 · AAB64530.1 · L_C144 · YLR320W . . . . L8543.13 · YLR320W .

yml050w

composite dataset

... YBR092C YNL068C YER124C YNL068C YOR247W YNL068C YGL257C YNL068C YMR198W YNL068C YML050W YNL068C YDR261C YNL068C ...

yml050w

Comments



Subscribe jansvalrcandlating.ml